powered by:
Protein Alignment Eig71Ed and Eig71Ek
DIOPT Version :9
Sequence 1: | NP_524091.1 |
Gene: | Eig71Ed / 39704 |
FlyBaseID: | FBgn0004591 |
Length: | 99 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648797.1 |
Gene: | Eig71Ek / 39712 |
FlyBaseID: | FBgn0014851 |
Length: | 97 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 37/71 - (52%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 CDELTRRCERCVETLNNAADRNLPVLNQECRTKTRNNWRWRNVGRCELTRLNCLGSNRR---MNC 86
|:.:...|:|....:.. .|..:...|:.||.:.|. ||.:|.|||:.:..||...|| |:|
Fly 27 CENIYNDCQRFTSRIGR-FDETIDSFNRHCRRERRG--RWNSVSRCEMEKATCLLIFRRCDDMSC 88
Fly 87 NDIAEL 92
|:||::
Fly 89 NNIADV 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Eig71Ed | NP_524091.1 |
L71 |
24..89 |
CDD:280587 |
21/66 (32%) |
Eig71Ek | NP_648797.1 |
L71 |
26..91 |
CDD:280587 |
21/66 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45462367 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.