DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eig71Ec and Eig71Ei

DIOPT Version :9

Sequence 1:NP_524090.2 Gene:Eig71Ec / 39703 FlyBaseID:FBgn0004590 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001261889.1 Gene:Eig71Ei / 39710 FlyBaseID:FBgn0014849 Length:102 Species:Drosophila melanogaster


Alignment Length:97 Identity:40/97 - (41%)
Similarity:53/97 - (54%) Gaps:7/97 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKITLIFAILCLCVA-VQAQ----TREQEICRQENETCRRNERRLGVQNDVSTTFNNHCRRQSG 60
            |.|:.|..||:||.:| :||.    .|..:||.:..:.|..||.|||.|:|.|..||::|||...
  Fly     1 MLKLLLPLAIVCLFMAHIQANPEEANRRHKICIRTYDKCIENEARLGKQDDTSKFFNDYCRRSDS 65

  Fly    61 IRNWRNVSRCELSLATCRLTLERCAVINCKNV 92
              .|.:||||:|....|..|:..|....||||
  Fly    66 --GWSDVSRCDLLRIACLSTVRDCETPTCKNV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eig71EcNP_524090.2 L71 26..92 CDD:280587 27/65 (42%)
Eig71EiNP_001261889.1 L71 31..95 CDD:280587 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012684
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.