DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eig71Ec and Eig71Eh

DIOPT Version :9

Sequence 1:NP_524090.2 Gene:Eig71Ec / 39703 FlyBaseID:FBgn0004590 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_648794.3 Gene:Eig71Eh / 39709 FlyBaseID:FBgn0014848 Length:101 Species:Drosophila melanogaster


Alignment Length:107 Identity:30/107 - (28%)
Similarity:47/107 - (43%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KITLIFAILCLCVAVQAQTREQEICRQENETCRRNERRLGVQNDVSTTFNNHCR-RQSGIRNWRN 66
            |:|:.|.::..||.|..|:.:   |::..:.|.:..:||....:.....|..|| |..|...|::
  Fly     2 KLTVCFLVILGCVIVHGQSPD---CKEIKDICSKCIQRLNDPYNKVDFINKGCRNRVRGSYVWKD 63

  Fly    67 VSRCELSLATCRL--TLERCAVI-NCKNVRNSIDGGVTARPP 105
            .:.|||....|..  ....|.|| :...:|.     ||.|||
  Fly    64 QNLCELQAIACSAPNRAMNCVVIADVAKMRR-----VTPRPP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eig71EcNP_524090.2 L71 26..92 CDD:280587 17/69 (25%)
Eig71EhNP_648794.3 L71 22..86 CDD:280587 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.