DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARHGDIB and RhoGDI

DIOPT Version :9

Sequence 1:NP_001166.3 Gene:ARHGDIB / 397 HGNCID:679 Length:201 Species:Homo sapiens
Sequence 2:NP_001262080.1 Gene:RhoGDI / 40179 FlyBaseID:FBgn0036921 Length:201 Species:Drosophila melanogaster


Alignment Length:203 Identity:100/203 - (49%)
Similarity:130/203 - (64%) Gaps:7/203 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDG---PVVTDP 62
            |.|...:.|.|..|||..|:  ||:.||:|:::|:...|::||||.:||:.|||..   .::.:|
  Fly     1 MAETETKHHPEHHDDDVHDA--NYQAPPEKTIEEIMAADQEDESLRRYKEALLGAAQTEKIIVEP 63

Human    63 KAP-NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYV 126
            ..| .|:|.:|.||.|.. ..:.:||||||..|||:..|:|||.:|:|:|.|.|.|:||.|||||
  Fly    64 NDPRKVIVKKLALVVEGR-DDMELDLTGDLSQLKKQLFVIKEGVQYKVRIDFIVQREIVHGLKYV 127

Human   127 QHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEW 191
            |.|.|.||.|||...|||||.|:.|...:|||.||||.|..:||||...|.||||||..||.|:|
  Fly   128 QKTSRLGVNVDKMKHMVGSYPPKKEIQFYLTPAEEAPSGTFSRGTYSVSSVFTDDDKHIHLEWDW 192

Human   192 NLSIKKEW 199
            ...|||:|
  Fly   193 TFEIKKDW 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARHGDIBNP_001166.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 14/36 (39%)
Rho_GDI 21..198 CDD:396612 90/180 (50%)
RhoGDINP_001262080.1 Rho_GDI 14..199 CDD:280310 94/187 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147093
Domainoid 1 1.000 197 1.000 Domainoid score I3096
eggNOG 1 0.900 - - E1_KOG3205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54245
OrthoDB 1 1.010 - - D1265661at2759
OrthoFinder 1 1.000 - - FOG0001289
OrthoInspector 1 1.000 - - otm40282
orthoMCL 1 0.900 - - OOG6_102354
Panther 1 1.100 - - LDO PTHR10980
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2126
SonicParanoid 1 1.000 - - X792
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.