DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phs and esg

DIOPT Version :9

Sequence 1:	NP_648789.3	Gene:	Phs / 39697	FlyBaseID:	FBgn0036522	Length:	971	Species:	Drosophila melanogaster
Sequence 2:	NP_476600.1	Gene:	esg / 34903	FlyBaseID:	FBgn0001981	Length:	470	Species:	Drosophila melanogaster

Alignment Length:	140	Identity:	47/140 - (33%)
Similarity:	73/140 - (52%)	Gaps:	9/140 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   685 YKCDICSMPLATKQDLSLHMRHH-------KNDRRYKCDKCNKGFVRSSDLSIHVRIHTGEKPYS 742
            |:|..|....:|...|:.|.:.|       :..:.:.|..|:|.:|....|.:|:|.||  .|..
  Fly   309 YQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHT--LPCK 371

  Fly   743 CDLCGKAFRARQNLVVHRRTHLGDKPIQCELCDKRFARKIDMRVHMRRHTGEKPYNCDACQRGYS 807
            |:||||||.....|..|.|||.|:||..|:.|.:.||.:.::|.|::.|:..|.|:|.:|.:.:|
  Fly   372 CNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFS 436

  Fly   808 SRVNLLRHQE 817
            ....|.:|.|
  Fly   437 RMSLLTKHSE 446

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phs	NP_648789.3	COG5048	<594..787	CDD:227381	37/108 (34%)
		C2H2 Zn finger	631..651	CDD:275368
		zf-H2C2_2	644..666	CDD:290200
		zf-H2C2_2	699..724	CDD:290200	6/31 (19%)
		zf-C2H2	713..735	CDD:278523	7/21 (33%)
		C2H2 Zn finger	715..735	CDD:275368	7/19 (37%)
		zf-H2C2_2	727..750	CDD:290200	11/22 (50%)
		C2H2 Zn finger	743..763	CDD:275368	10/19 (53%)
		zf-H2C2_2	755..780	CDD:290200	11/24 (46%)
		C2H2 Zn finger	771..791	CDD:275368	6/19 (32%)
		zf-H2C2_2	783..808	CDD:290200	7/24 (29%)
		C2H2 Zn finger	799..816	CDD:275370	4/16 (25%)
esg	NP_476600.1	zf-C2H2	309..331	CDD:278523	6/21 (29%)
		C2H2 Zn finger	311..331	CDD:275370	5/19 (26%)
		zf-C2H2	344..366	CDD:278523	7/21 (33%)
		C2H2 Zn finger	346..366	CDD:275368	7/19 (37%)
		zf-C2H2	370..392	CDD:278523	10/21 (48%)
		C2H2 Zn finger	372..392	CDD:275368	10/19 (53%)
		zf-H2C2_2	385..408	CDD:290200	10/22 (45%)
		zf-C2H2	398..420	CDD:278523	6/21 (29%)
		C2H2 Zn finger	400..420	CDD:275368	6/19 (32%)
		C2H2 Zn finger	428..444	CDD:275368	4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24377
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100