DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phs and ref-2

DIOPT Version :10

Sequence 1:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster
Sequence 2:NP_001024478.1 Gene:ref-2 / 183539 WormBaseID:WBGene00004335 Length:315 Species:Caenorhabditis elegans


Alignment Length:222 Identity:64/222 - (28%)
Similarity:95/222 - (42%) Gaps:57/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 AFRLKMRLVEHQL--------------RHRAEKAYKC------DICSMPLATKQDLSLHM--RHH 707
            :|.:.|..|.|.|              .:..:|..:|      .:|........:||.|:  .|.
 Worm    49 SFYMNMSQVPHFLPAQVDPFIYPNTLGSYGGDKQVQCLWETNGQVCMHVCQNSGELSTHISSNHI 113

  Fly   708 KNDRRY-----KCDKCNKGFVRSSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVHRRTHLGDK 767
            .:|.::     .||:..|.|.....|..|:|:||||:|:.||:|.|.|...:||.:|:|.|.|:|
 Worm   114 THDSKFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDVCNKVFARSENLKIHKRIHSGEK 178

  Fly   768 PIQC--ELCDKRFARKIDMRVHMRRHTGEKPYNC--DACQRGYSSRVNLLRHQEREHGIEEQVPG 828
            |.||  ..|.|.||...|.:.||..|:..|||:|  ..|.:.|:...:|                
 Worm   179 PFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSL---------------- 227

  Fly   829 SGQADKKHTKTATENEQENEPKAKAAP 855
                 :||||.     .|||.|::.:|
 Worm   228 -----RKHTKV-----HENEKKSQLSP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhsNP_648789.3 COG5048 <594..787 CDD:227381 45/150 (30%)
C2H2 Zn finger 631..651 CDD:275368
C2H2 Zn finger 715..735 CDD:275368 7/19 (37%)
C2H2 Zn finger 743..763 CDD:275368 9/19 (47%)
C2H2 Zn finger 771..791 CDD:275368 8/21 (38%)
zf-H2C2_2 783..808 CDD:463886 10/26 (38%)
C2H2 Zn finger 799..816 CDD:275370 4/18 (22%)
ref-2NP_001024478.1 COG5048 150..>227 CDD:227381 30/76 (39%)
C2H2 Zn finger 154..174 CDD:275368 9/19 (47%)
C2H2 Zn finger 182..204 CDD:275368 8/21 (38%)
C2H2 Zn finger 212..234 CDD:275368 8/47 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.