DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phs and ZNF565

DIOPT Version :10

Sequence 1:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster
Sequence 2:NP_689690.3 Gene:ZNF565 / 147929 HGNCID:26726 Length:499 Species:Homo sapiens


Alignment Length:199 Identity:88/199 - (44%)
Similarity:108/199 - (54%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 IHT------CNFCGKTFKRFSRMQDHLRLHTGEKPYVCGQCGRAFRLKMRLVEHQLRHRAEKAYK 686
            |||      |..|||.|.|.|.:..|.|:|||||||.|..||:||.....|:.||..|...|.|:
Human   188 IHTGEKPFGCKECGKAFSRASHLVQHQRIHTGEKPYDCKDCGKAFGRTSELILHQRLHTGVKPYE 252

  Fly   687 CDICSMPLATKQDLSLHMRHHKNDRRYKCDKCNKGFVRSSDLSIHVRIHTGEKPYSCDLCGKAFR 751
            |..|.........|.||.|.|..::.|.|..|.|.|:|.|.|::|.|||||.:||.|..||||||
Human   253 CKECGKTFRQHSQLILHQRTHTGEKPYVCKDCGKAFIRGSQLTVHRRIHTGARPYECKECGKAFR 317

  Fly   752 ARQNLVVHRRTHLGDKPIQCELCDKRFARKIDMRVHMRRHTGEKPYNCDACQRGYSSRVNLLRHQ 816
            ....|.||:|.|.|:||.:|:.|.|.|....::..|.|.|:|||||.|..|.:.:.....|.|||
Human   318 QHSQLTVHQRIHTGEKPYECKECGKGFIHSSEVTRHQRIHSGEKPYECKECGKAFRQHAQLTRHQ 382

  Fly   817 EREH 820
             |.|
Human   383 -RVH 385

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PhsNP_648789.3 COG5048 <594..787 CDD:227381 72/164 (44%)
C2H2 Zn finger 631..651 CDD:275368 9/19 (47%)
C2H2 Zn finger 715..735 CDD:275368 9/19 (47%)
C2H2 Zn finger 743..763 CDD:275368 11/19 (58%)
C2H2 Zn finger 771..791 CDD:275368 6/19 (32%)
zf-H2C2_2 783..808 CDD:463886 10/24 (42%)
C2H2 Zn finger 799..816 CDD:275370 4/16 (25%)
ZNF565NP_689690.3 KRAB 6..66 CDD:214630