DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comm3 and comm2

DIOPT Version :9

Sequence 1:NP_001287072.1 Gene:comm3 / 39696 FlyBaseID:FBgn0259236 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_648801.2 Gene:comm2 / 39716 FlyBaseID:FBgn0041160 Length:343 Species:Drosophila melanogaster


Alignment Length:353 Identity:89/353 - (25%)
Similarity:159/353 - (45%) Gaps:84/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADLLKALN-----------ITGNLLAGLEDAGNLTIATATTTTLSEGLNGNATTLDAAASTSSG 54
            |.:|.:|||           ..|.....:.::|..:...:|.|         .|||||.:|:   
  Fly     1 MEELPRALNYELSHDLHFDHYAGAAAQKILNSGRSSPEASTPT---------ITTLDAISSS--- 53

  Fly    55 EKLDLGGFDLPGNYSILINKLEQLALGLDSALGNFTIDRQEVEINLSGAATANDVADVADDLFDV 119
                              :.|:|:...:.|:: ......|..|::....:|:.::.|     ||:
  Fly    54 ------------------DFLKQIGQQILSSI-QLKHQHQLNEVSHPRNSTSEEIMD-----FDL 94

  Fly   120 LPAARAPPPHIAHGSRIYTGDDGQDFAHVVSDIWIGVILTLLIVFVIFFICACFVYHKFQQWKNS 184
              |.|.    |...|.:.......::...::::|||::.||:::.::|.||:||:||:|:.||.:
  Fly    95 --ANRV----ILDSSSVDQLQQQLEYDKFMNEVWIGIVFTLILISMVFCICSCFLYHQFRTWKRN 153

  Fly   185 YRANHSDPT----IEI-CRRCPPDYEAESLPSYTIVSGLPTYDDALEEFRKAG----IILTPAMV 240
            ||.|.:..|    ::| ..:..||.| :.:|.||:|||||:|:.|||..:|:.    :|:.|:  
  Fly   154 YRNNANGSTQCTIVDIEALKLHPDVE-DPVPEYTLVSGLPSYEAALELLQKSPQSSCLIVYPS-- 215

  Fly   241 PIIKIFECNETGKEQAVGYSLVETNIASA--DAAADNVSLASTTCNCGNSSP-----TSSLPSYS 298
             :..:|     .|::.....|....:|::  .||.:|.....|...|..:.|     |::..:::
  Fly   216 -VFNVF-----NKQERSSQELQHPGVATSAPPAAPENHLAPQTPSFCDATMPLLPATTAAAATHA 274

  Fly   299 AAT-AAVMAAAA-----AAPPQVIELSP 320
            ||| .||.||.|     ||.|....:.|
  Fly   275 AATVTAVTAATATSATLAASPTCESIKP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comm3NP_001287072.1 Comm 144..247 CDD:292579 38/111 (34%)
comm2NP_648801.2 Comm 113..224 CDD:292579 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BYRM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012734
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.