DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7650 and Pdcl2

DIOPT Version :10

Sequence 1:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_075997.1 Gene:Pdcl2 / 79455 MGIID:1890655 Length:240 Species:Mus musculus


Alignment Length:102 Identity:26/102 - (25%)
Similarity:46/102 - (45%) Gaps:21/102 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 TFPEKGNQEPGVTPADLIFVVDEKPH---SVFKRDGNDLILEKKVSLIDALTGLTISVTTLDGRS 289
            |:.||..:.||..| ::|:...::|.   |..|.:|       |...:|.....:.|:|.|...:
Mouse   368 TYKEKVKKRPGGRP-EVIYNYVQRPFIRMSWEKEEG-------KSRHVDFQCVKSKSITNLAAAA 424

  Fly   290 LTIP--VLDIVKPGQEI----VIPNEGMPTK----DP 316
            ..||  .|.::.||.::    ::||...|::    ||
Mouse   425 ADIPQDQLVVMHPGPQVDELDILPNHPQPSQHYEPDP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 11/41 (27%)
Pdcl2NP_075997.1 Phd_like_VIAF 8..200 CDD:239286
Thioredoxin fold. /evidence=ECO:0000250 89..240
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.