DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7650 and PDC

DIOPT Version :9

Sequence 1:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_002588.3 Gene:PDC / 5132 HGNCID:8759 Length:246 Species:Homo sapiens


Alignment Length:218 Identity:74/218 - (33%)
Similarity:133/218 - (61%) Gaps:6/218 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 STNTGPKGVVKDWQRFKQLEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELDAELDELM 127
            :|:||||||:.||::|| ||::..|.....:..:.::::...:.:.:|.:.:...::..:..||:
Human    17 ATHTGPKGVINDWRKFK-LESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI 80

  Fly   128 -----SEDFLQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIYERQL 187
                 .|:.|::|::|.|.:|.::.....::|.|.:|.:.::||..:|:|.|.|||::||||..:
Human    81 HKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHIYEDGI 145

  Fly   188 AACATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVIGNFVRLTDDLSD 252
            ..|..||..|..||::||.:||.||.:|..|....|....||.||:||...:|.||:.:.:..::
Human   146 KGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDRFSLDVLPTLLIYKGGELISNFISVAEQFAE 210

  Fly   253 DFFASDVESFLIEHGIIVDRALY 275
            :|||.||||||.|:|::.:|.::
Human   211 EFFAGDVESFLNEYGLLPEREVH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 72/208 (35%)
PDCNP_002588.3 Phosducin 1..246 CDD:251094 74/218 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 15/53 (28%)
Phd_like_Phd 14..225 CDD:239285 72/208 (35%)
Thioredoxin fold. /evidence=ECO:0000250 111..246 51/123 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158650
Domainoid 1 1.000 194 1.000 Domainoid score I3177
eggNOG 1 0.900 - - E1_KOG3171
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55912
OrthoDB 1 1.010 - - D1324495at2759
OrthoFinder 1 1.000 - - FOG0002881
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.