DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7650 and SPBC2A9.09

DIOPT Version :9

Sequence 1:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_596219.1 Gene:SPBC2A9.09 / 2540484 PomBaseID:SPBC2A9.09 Length:233 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:52/169 - (30%)
Similarity:80/169 - (47%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DWQ---RFKQLEAERR---DETERQRLALAKKLTITATTSAEDEERKRQEELD--AELDELMSED 130
            :|.   |.|.:..|:.   |:.....|..||:|.        .|.|...::||  |||::...::
pombe     8 EWNDILRSKGILPEKEPDVDDVLDDALVDAKQLA--------HENRLENKDLDELAELEDEEDDE 64

  Fly   131 FLQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIYERQLAACATLNK 195
            |||.|:.:||.|...|.. ..:||.|..: |..|:.|.|...:|...:::|:::..|.||..|..
pombe    65 FLQMYRNKRMQEWKDQMS-KAKFGSVYPI-SKPEYTAEVTDASKEVFVVVHMFQDSLPACKLLAA 127

  Fly   196 CLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVY 234
            .|:.||..||.|||.||....|  ..::....:|.||:|
pombe   128 ILERLAPMYPQIKFVKIPGKQA--VENYPEAMMPTLLIY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 52/169 (31%)
SPBC2A9.09NP_596219.1 Phd_like_VIAF 7..197 CDD:239286 52/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.