DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7650 and mau-8

DIOPT Version :9

Sequence 1:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001255734.1 Gene:mau-8 / 190455 WormBaseID:WBGene00003142 Length:258 Species:Caenorhabditis elegans


Alignment Length:268 Identity:74/268 - (27%)
Similarity:128/268 - (47%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LEDKLLGEKLEYYCSSSEGEDN-----GDEGGDNKGASGKSRCSGLTIDTNPDATPAGGFRQQSS 63
            ||.::|..|...||||||||::     .||  |...|:...|..                   .|
 Worm     3 LESRILDGKPAGYCSSSEGEEDDFKVVNDE--DEHQANVMKRMG-------------------PS 46

  Fly    64 TNTGPKGVVKDWQRFKQLEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELDAELDELMS 128
            :|||.|||:.:::.|:: :.....|::.|:|....|..:...:..|.|:.:|:::.|        
 Worm    47 SNTGAKGVLNEFKAFRE-QTRLAVESKNQKLIEQAKKGMMIGSKEEREKAQREDDED-------- 102

  Fly   129 EDF---LQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIYERQLAAC 190
            |||   |:..:.:|:.||.:...:     :|.::|..:::...|:..:.:...:: |||.:...|
 Worm   103 EDFEMTLEGLKAKRLREMRKIAAN-----RVIEMTDKKQYSDAVDGSSSYLLCVL-IYEPESDEC 161

  Fly   191 ATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVIGNFVRLTDDLSDDFF 255
            ..|.:.:..||:|.|..||.:..|::..|||.|||.|:|.|..|....:|||||:::..|..|:.
 Worm   162 EYLTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVKISAILGQDYD 226

  Fly   256 ASDVESFL 263
            ...:..||
 Worm   227 CKKLTKFL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 57/207 (28%)
mau-8NP_001255734.1 Phd_like_Phd 43..238 CDD:239285 57/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166849
Domainoid 1 1.000 64 1.000 Domainoid score I6742
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I3656
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55912
OrthoDB 1 1.010 - - D1324495at2759
OrthoFinder 1 1.000 - - FOG0002881
OrthoInspector 1 1.000 - - oto18899
orthoMCL 1 0.900 - - OOG6_105152
Panther 1 1.100 - - LDO PTHR46052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4364
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.