DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7650 and txdc-9

DIOPT Version :9

Sequence 1:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_498410.1 Gene:txdc-9 / 182257 WormBaseID:WBGene00006515 Length:208 Species:Caenorhabditis elegans


Alignment Length:169 Identity:36/169 - (21%)
Similarity:80/169 - (47%) Gaps:24/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 QEELDAELDEL--MSEDFLQQYQKQRMAEM---------LRQTGHHQQFGQVQQLTSHEEFLACV 169
            :|::|.|:::|  :.||.|:..::|||.:|         :...||    |:.:::...:||....
 Worm    21 EEQIDQEMNKLENLEEDDLEVIRRQRMEQMKKAQKDRIEMLSHGH----GKYEEVADEKEFFEAT 81

  Fly   170 EQENKHTTIIIHIYERQLAACATLNKCLDSLASDYPSIKFAKI-CSSVAGMSRDFRTKGLPAL-L 232
            ::.:|   ::...|......|..::|..:.||..:...:|..: ...|..::.....:.:|:: :
 Worm    82 KKSDK---VVCLFYLPGNFRCKIVDKHFEILARKHVGTRFIHVNAEKVHFLTTRLNIRVIPSIAI 143

  Fly   233 VYKAQAVIGNFVRLTDDL--SDDFFASDVESFLIEHGII 269
            |.|.|.|  :::|..|:|  .|:|....:|:.|....::
 Worm   144 VVKQQTV--DYIRGFDELGGKDEFTTETMENRLARSEVL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 36/165 (22%)
txdc-9NP_498410.1 Phd_like_TxnDC9 63..175 CDD:239287 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.