DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7650 and pdc

DIOPT Version :9

Sequence 1:NP_648786.1 Gene:CG7650 / 39694 FlyBaseID:FBgn0036519 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_002933816.2 Gene:pdc / 100496611 XenbaseID:XB-GENE-983832 Length:249 Species:Xenopus tropicalis


Alignment Length:219 Identity:83/219 - (37%)
Similarity:140/219 - (63%) Gaps:10/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSTNTGPKGVVKDWQRFKQLEAERRDETERQRLALAKKLTITATTSAEDEERKRQEELDAELD-- 124
            |:||||||||:.||::|| |.:|.::.....:..:.::::.......:| |:..:|:|..::.  
 Frog    18 SATNTGPKGVIHDWRKFK-LISEDQESIPPNKKEILRQMSSPYKPPIKD-EKDTKEKLSRKMSMQ 80

  Fly   125 --ELMS----EDFLQQYQKQRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIY 183
              ||::    |..|::|:||.|.:|.::.....::|.:.:|.|.:|||..:|:|:|.||:|:||:
 Frog    81 EYELINDKEDEHCLKKYRKQCMHDMHQRLSFGPKYGYLVELKSGDEFLEAIEKESKTTTVIVHIF 145

  Fly   184 ERQLAACATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVIGNFVRLTD 248
            ...:..|..||.||..||.:||::||.||.::..|....|.::.||.||||||..:|.||:.:|:
 Frog   146 ADDIKGCEALNNCLTCLALEYPTVKFCKIKAADTGAGERFSSEVLPTLLVYKAGELISNFISVTE 210

  Fly   249 DLSDDFFASDVESFLIEHGIIVDR 272
            :|:|:|||.||||||.|:|::.:|
 Frog   211 NLNDEFFAVDVESFLNEYGLLPER 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7650NP_648786.1 Phd_like_Phd 60..267 CDD:239285 81/212 (38%)
pdcXP_002933816.2 Phd_like_Phd 16..229 CDD:239285 81/212 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 183 1.000 Domainoid score I3373
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55912
OrthoDB 1 1.010 - - D1324495at2759
OrthoFinder 1 1.000 - - FOG0002881
OrthoInspector 1 1.000 - - otm49062
Panther 1 1.100 - - O PTHR46052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.030

Return to query results.
Submit another query.