DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and RAD6

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_011457.1 Gene:RAD6 / 852822 SGDID:S000003026 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:75/236 - (31%)
Similarity:113/236 - (47%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            |:.|.|.|..::|.::|:...|.....: .||:..|...|.||.||.|:.|.|:..::|..:||.
Yeast     2 STPARRRLMRDFKRMKEDAPPGVSASPL-PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPN 65

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167
            .||.::||::::|||||.||::|:.||.             .||.||.:|.:||.|:.||.|:||
Yeast    66 KPPHVKFLSEMFHPNVYANGEICLDILQ-------------NRWTPTYDVASILTSIQSLFNDPN 117

  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPTT 232
            ..|||||:|:.::        ||::...:.|.                             |.|.
Yeast   118 PASPANVEAATLF--------KDHKSQYVKRV-----------------------------KETV 145

  Fly   233 ESGLDANFYDDDFDLETEDDLPSDDDFDEDDDDDEDEDEDE 273
            |.             ..|||:   ||.|:|||||:|:|:||
Yeast   146 EK-------------SWEDDM---DDMDDDDDDDDDDDDDE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 52/143 (36%)
COG5078 45..182 CDD:227410 51/136 (38%)
RAD6NP_011457.1 COG5078 1..150 CDD:227410 60/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.