DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and CDC34

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_010339.1 Gene:CDC34 / 851624 SGDID:S000002461 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:101/310 - (32%)
Similarity:161/310 - (51%) Gaps:64/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSAVRALAMEYKSLQE--EPVEGFRVKLINDDNLFEWEVAIFG-PPDTLYQGGYFKAHMKFPHDY 100
            |:|...|..:|:.|.:  :.:..|.::|.:|.|:|.|.:.:.. ..|::|.||:|||.|:||.|:
Yeast     6 STASSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDF 70

  Fly   101 PYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNE 165
            |:|||..||...::|||||.:|.|||||||.. .||.:.|...|.|:|.|.|.::|:|::|||.:
Yeast    71 PFSPPQFRFTPAIYHPNVYRDGRLCISILHQS-GDPMTDEPDAETWSPVQTVESVLISIVSLLED 134

  Fly   166 PNTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKRE----GIVVPMTLEDYCLKP 226
            ||..|||||||:|.||:      ...:|     ||.:....|..::    |.::| |.|...:..
Yeast   135 PNINSPANVDAAVDYRK------NPEQY-----KQRVKMEVERSKQDIPKGFIMP-TSESAYISQ 187

  Fly   227 TRKPTTESGLDA--NFY----------------DDDFDLETEDDLPSDDD----FDEDDDDDE-- 267
            ::....||..|.  ||:                |||:| :..:.:|.:||    ::::|||||  
Yeast   188 SKLDEPESNKDMADNFWYDSDLDDDENGSVILQDDDYD-DGNNHIPFEDDDVYNYNDNDDDDERI 251

  Fly   268 ----DEDEDEDSATAPISKNNGGSSKCKNNGLV-REAAAAGADDAESADD 312
                |:|:|:||              ..|:.:: |:......|::|..:|
Yeast   252 EFEDDDDDDDDS--------------IDNDSVMDRKQPHKAEDESEDVED 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 64/146 (44%)
COG5078 45..182 CDD:227410 63/139 (45%)
CDC34NP_010339.1 COG5078 3..170 CDD:227410 70/175 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3210
Inparanoid 1 1.050 160 1.000 Inparanoid score I1063
Isobase 1 0.950 - 0 Normalized mean entropy S539
OMA 1 1.010 - - QHG52149
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104162
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1472
TreeFam 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.