DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBC9

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_010219.1 Gene:UBC9 / 851495 SGDID:S000002222 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:52/168 - (30%)
Similarity:79/168 - (47%) Gaps:21/168 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLI----NDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPH 98
            ||..::.|..|.|..:::...||..|.:    ...:|.:||..|.|...|.:.||.:...:::|:
Yeast     2 SSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPN 66

  Fly    99 DYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLL 163
            :||..||.::|....:|||||.:|.:|:|||:...|           |.|...::.|:|.|..||
Yeast    67 EYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQD-----------WRPAITLKQIVLGVQDLL 120

  Fly   164 NEPNTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQA 201
            :.||..|||...|      ||.......||...:..||
Yeast   121 DSPNPNSPAQEPA------WRSFSRNKAEYDKKVLLQA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 46/147 (31%)
COG5078 45..182 CDD:227410 44/140 (31%)
UBC9NP_010219.1 COG5078 1..157 CDD:227410 52/168 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.