DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBC14

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001190096.1 Gene:UBC14 / 824704 AraportID:AT3G55380 Length:201 Species:Arabidopsis thaliana


Alignment Length:186 Identity:78/186 - (41%)
Similarity:111/186 - (59%) Gaps:37/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            ::.|...|..:.|.|.::||:||...|:::.|:|:|.|:|.|||||||:||:|.|.|.||.:||.
plant     3 NNQASLLLQKQLKDLCKKPVDGFSAGLVDEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPV 67

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPT------------------ 149
            |||::.|.:::||||||.:|.:||||||||.|||...||..|||.|.                  
plant    68 SPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTLVETDMFCSILSLYSD 132

  Fly   150 --QNVR--------------TILLSVISLLNEPNTFSPANVDASVMYRRWRDSQGK 189
              .|||              :|:||:||:|:.||..|||||:|:   :.|||::.:
plant   133 CFSNVRGIYKSGLRNTLEDKSIVLSIISMLSGPNDESPANVEAA---KEWRDNRAE 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 76/177 (43%)
COG5078 45..182 CDD:227410 74/170 (44%)
UBC14NP_001190096.1 COG5078 19..197 CDD:227410 74/170 (44%)
UQ_con 19..194 CDD:278603 74/170 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.