DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBC13

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_566884.1 Gene:UBC13 / 823796 AraportID:AT3G46460 Length:166 Species:Arabidopsis thaliana


Alignment Length:162 Identity:82/162 - (50%)
Similarity:109/162 - (67%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            :|.|...|..:.|.|.:.||:||...|:::.|:|||.|.|.|||||||:||:|.|.|.||.:||.
plant     2 NSQACLLLQKQLKDLCKHPVDGFSAGLVDEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPN 66

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167
            |||::||.:.:||||||.:|.:||||||||.|||...||..|||.|...|.:|:||:||:|:.||
plant    67 SPPTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLSIISMLSGPN 131

  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIRK 199
            ..|||||:|:..:|..||...|  :....:||
plant   132 DESPANVEAAKEWREKRDEFKK--KVSRCVRK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 76/143 (53%)
COG5078 45..182 CDD:227410 74/136 (54%)
UBC13NP_566884.1 UQ_con 18..159 CDD:395127 75/142 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.