DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and ube2r2

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001072702.1 Gene:ube2r2 / 780159 XenbaseID:XB-GENE-994678 Length:238 Species:Xenopus tropicalis


Alignment Length:239 Identity:159/239 - (66%)
Similarity:198/239 - (82%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYS 103
            :|:.:||.:|.||||||||||||:.|:::.:|:.|||||||||:|||:|||||||:|||.|||||
 Frog     7 TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYS 71

  Fly   104 PPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNT 168
            ||:.|||||:||||:|||||:||||||||||||||||||.|||||||||||||||||||||||||
 Frog    72 PPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNT 136

  Fly   169 FSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPTTE 233
            |||||||||||:|:||||:|||.||..|||||..|..|||:::|:.||.||.:||:| |:.|:::
 Frog   137 FSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIK-TKVPSSD 200

  Fly   234 SGLDANFYDDDFDLETEDDLPSDDDFDEDDDDDEDED--EDEDS 275
            :..|. .|||.:          |||.|::|:::||.|  :|:||
 Frog   201 NSSDL-LYDDLY----------DDDIDDEDEEEEDADCYDDDDS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 117/143 (82%)
COG5078 45..182 CDD:227410 113/136 (83%)
ube2r2NP_001072702.1 UBCc 11..169 CDD:238117 128/157 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1936
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3210
Inparanoid 1 1.050 339 1.000 Inparanoid score I2323
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - oto104756
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.