DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBE2G2

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_003334.2 Gene:UBE2G2 / 7327 HGNCID:12483 Length:165 Species:Homo sapiens


Alignment Length:163 Identity:81/163 - (49%)
Similarity:102/163 - (62%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            :.:|::.|..|||.|...|.||.....:|::|.||||..|.||.||.::.|.|.|.:.||.|||.
Human     2 AGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPL 66

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167
            |||.:||..:::|||:|.:|.:||||||.|.|||...|...|||:|.|:|..|||||:|:|.|||
Human    67 SPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPN 131

  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQ 200
            ..|.||||||.|   |||    |.|....|.||
Human   132 DESGANVDASKM---WRD----DREQFYKIAKQ 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 74/143 (52%)
COG5078 45..182 CDD:227410 72/136 (53%)
UBE2G2NP_003334.2 COG5078 1..163 CDD:227410 81/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.