DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2r2

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001121045.1 Gene:Ube2r2 / 689226 RGDID:1594826 Length:238 Species:Rattus norvegicus


Alignment Length:239 Identity:159/239 - (66%)
Similarity:197/239 - (82%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYS 103
            :|:.:||.:|.||||||||||||:.|:::.:|:.|||||||||:|||:|||||||:|||.|||||
  Rat     7 TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYS 71

  Fly   104 PPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNT 168
            ||:.|||||:||||:|||||:||||||||||||||||||.|||||||||||||||||||||||||
  Rat    72 PPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNT 136

  Fly   169 FSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPTTE 233
            |||||||||||:|:||||:|||.||..|||||..|..|||:::|:.||.||.:||:| |:.|:.:
  Rat   137 FSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIK-TKVPSND 200

  Fly   234 SGLDANFYDDDFDLETEDDLPSDDDFDEDDDDDEDED--EDEDS 275
            :..|. .|||.:          |||.|::|:::||.|  :|:||
  Rat   201 NSSDL-LYDDLY----------DDDIDDEDEEEEDADCYDDDDS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 117/143 (82%)
COG5078 45..182 CDD:227410 113/136 (83%)
Ube2r2NP_001121045.1 UBCc 11..169 CDD:238117 128/157 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1902
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3210
Inparanoid 1 1.050 339 1.000 Inparanoid score I2292
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - otm45987
orthoMCL 1 0.900 - - OOG6_104162
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.