DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2t

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001265044.1 Gene:Ube2t / 67196 MGIID:1914446 Length:204 Species:Mus musculus


Alignment Length:213 Identity:54/213 - (25%)
Similarity:89/213 - (41%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAMEYKSLQEEPVEG---FRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPS 106
            |..|...|..||..|   ::.|    |.:.:....|.|..:|.|:.|.|...:..|..||:.||.
Mouse     7 LKKELHMLAIEPPPGITCWQEK----DQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQ 67

  Fly   107 IRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSP 171
            :||||.::|||:..:|.:|:.||..|         |...|.|:.|:.|:|.|:..|:.|||...|
Mouse    68 VRFLTPIYHPNIDSSGRICLDILKLP---------PKGAWRPSLNIATVLTSIQLLMAEPNPDDP 123

  Fly   172 ANVDASVMY-----------RRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLK 225
            ...|.|..:           ::|.::..:..:..:   ::.|..::|....        |:....
Mouse   124 LMADISSEFKYNKIAFLKKAKQWTEAHARQKQKAD---EEELGTSSEVGDS--------EESHST 177

  Fly   226 PTRKPTTESGLDANFYDD 243
            ..||.....|::..|..|
Mouse   178 QKRKARPLGGMEKKFSPD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 46/154 (30%)
COG5078 45..182 CDD:227410 45/150 (30%)
Ube2tNP_001265044.1 COG5078 1..151 CDD:227410 46/156 (29%)
UBCc 5..147 CDD:238117 45/152 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..204 8/57 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.