DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2w

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_006495620.1 Gene:Ube2w / 66799 MGIID:1914049 Length:174 Species:Mus musculus


Alignment Length:132 Identity:42/132 - (31%)
Similarity:69/132 - (52%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSAVRALAMEYKSLQEEPVEGFRVKLIND----DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHD 99
            :|..:.|..|..:||.:|..|.   .:|:    :::.:|.|.:.|.|.|||:|..|:...||...
Mouse    31 ASMQKRLQKELLALQNDPPPGM---TLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSR 92

  Fly   100 YPYSPPSIRFLTK--VWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISL 162
            ||:..|.:.|..:  ..||:||.||.:|:|||             .|.|:|..:|:::.||:||:
Mouse    93 YPFDSPQVMFTGENIPIHPHVYSNGHICLSIL-------------TEDWSPALSVQSVCLSIISM 144

  Fly   163 LN 164
            |:
Mouse   145 LS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 41/129 (32%)
COG5078 45..182 CDD:227410 41/126 (33%)
Ube2wXP_006495620.1 UQ_con 36..>148 CDD:365926 41/127 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.