DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBE2Z

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_075567.2 Gene:UBE2Z / 65264 HGNCID:25847 Length:354 Species:Homo sapiens


Alignment Length:339 Identity:78/339 - (23%)
Similarity:126/339 - (37%) Gaps:83/339 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGSGSLATSSSAAAPTT-TPSSSAVRALAM---------------------------EYKSLQEE 55
            |.:|......|..||.. .|.|:|....|:                           :..|:.:|
Human    50 AAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKE 114

  Fly    56 PVEGFRVKLINDD-NLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTK-----VW 114
            |..|..|  :.|. ::.:....|.||.||.|:||:|....:.|.|||..||.::.:|.     .:
Human   115 PPPGMFV--VPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRF 177

  Fly   115 HPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVM 179
            :||.|.||.:|:|||         |......|:|.|::.::|:|:.||:.|    :|.:.:....
Human   178 NPNFYRNGKVCLSIL---------GTWTGPAWSPAQSISSVLISIQSLMTE----NPYHNEPGFE 229

  Fly   180 YRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPTTESGLDANFYDDD 244
            ..|   ..|....|...||.:.:       |..:...|..:..|.:|.|....:|.|:   |.|.
Human   230 QER---HPGDSKNYNECIRHETI-------RVAVCDMMEGKCPCPEPLRGVMEKSFLE---YYDF 281

  Fly   245 FDLETEDDLPSDDDFDEDDDDDEDEDEDEDSATAPISKNNGG---SSKCKNNGLVREAAAAGA-- 304
            :::..:|.|.......:|                |..:..|.   .|.....||:|:......  
Human   282 YEVACKDRLHLQGQTMQD----------------PFGEKRGHFDYQSLLMRLGLIRQKVLERLHN 330

  Fly   305 DDAESADDSGKGET 318
            ::||...||....|
Human   331 ENAEMDSDSSSSGT 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 43/176 (24%)
COG5078 45..182 CDD:227410 42/169 (25%)
UBE2ZNP_075567.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
UBCc 103..221 CDD:238117 40/132 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..354 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.