DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBE2D4

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 / 51619 HGNCID:21647 Length:192 Species:Homo sapiens


Alignment Length:185 Identity:58/185 - (31%)
Similarity:86/185 - (46%) Gaps:23/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASTSQHATSSSTMMAGSGSLATSSSAAAPTTTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDN 69
            |..::....:|.....||||.:...|         ...:|..:|...||.:|........:.|| 
Human    20 AGCTRSMVPASASGEASGSLQSWQKA---------KEKQACHLELTDLQRDPPAQCSAGPVGDD- 74

  Fly    70 LFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVD 134
            ||.|:..|.||.|:.||||.|...:.||.|||:.||.:.|.||::|||:..||.:|:.||.    
Human    75 LFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILR---- 135

  Fly   135 DPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRRWRDSQGK 189
                     .:|:|...|..:|||:.|||.:||...|...:.:..|:..|:...:
Human   136 ---------SQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 51/143 (36%)
COG5078 45..182 CDD:227410 49/136 (36%)
UBE2D4XP_024302563.1 UBCc 54..191 CDD:320784 50/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.