DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and peo

DIOPT Version :10

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:peo / 47272 FlyBaseID:FBgn0288856 Length:244 Species:Drosophila melanogaster


Alignment Length:73 Identity:24/73 - (32%)
Similarity:34/73 - (46%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYP--YSPPSIRFL 110
            |||.::.|.:.|..| :.:..|..:|....|| ...||....|:..:..|..:|  .|.|||.|.
  Fly    28 EYKMIESEKLSGIYV-IPSYANSLQWFGVFFG-RQGLYAESVFRFTILLPDRFPDDKSLPSIIFQ 90

  Fly   111 TKVWHPNV 118
            ..|.||:|
  Fly    91 QDVIHPHV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc_UBE2R 43..212 CDD:467423 24/73 (33%)
peoNP_524888.1 UEV_AKTIP 23..135 CDD:467434 24/73 (33%)

Return to query results.
Submit another query.