DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and cdc34

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001004793.1 Gene:cdc34 / 448013 XenbaseID:XB-GENE-5772505 Length:237 Species:Xenopus tropicalis


Alignment Length:247 Identity:157/247 - (63%)
Similarity:196/247 - (79%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 APTTTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKF 96
            |....|..|:.:||.:|.|.|||||||||||.|:::.:|:.|||||||||:|||:||||||.:||
 Frog     2 ARPVAPVPSSQKALMLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTLYEGGYFKARLKF 66

  Fly    97 PHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVIS 161
            |.|||||||:.|||||:||||:|||||:||||||||||||||||||.||||||||||||||||||
 Frog    67 PVDYPYSPPAFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVIS 131

  Fly   162 LLNEPNTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKP 226
            ||||||||||||||||||||:|:||:|:|.||.:|||||.::..|:|:.:|:.||.||.:||:| 
 Frog   132 LLNEPNTFSPANVDASVMYRKWKDSKGRDKEYTDIIRKQVVSTKADAEHDGVKVPTTLAEYCVK- 195

  Fly   227 TRKPTTESGLDANFYDDDFDLETEDDLPSDDDFDEDDD---DDEDEDEDEDS 275
            |:.|..:.|.|. ||||.:|         ||:.:||:|   :.:|:..:|:|
 Frog   196 TKAPAPDEGSDL-FYDDYYD---------DDEMEEDEDSCYEGQDDSGNEES 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 116/143 (81%)
COG5078 45..182 CDD:227410 113/136 (83%)
cdc34NP_001004793.1 UBCc 13..164 CDD:238117 121/150 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8622
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4188
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.