DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ubc7

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:162 Identity:80/162 - (49%)
Similarity:105/162 - (64%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            :.||:|.|..|||.|..:|.||.....|::||.||||..|.||..|.::||.|.|.:.||.|||.
  Fly     2 AGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPL 66

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167
            |||.::|...::|||::.:|.:||||||.|.|||...||..|||:|.|:|..|||||:|:|.|||
  Fly    67 SPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPN 131

  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIRK 199
            ..|.|||||::|:|..||      |:..|.|:
  Fly   132 DESGANVDAAIMWREQRD------EFNAIARR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 74/143 (52%)
COG5078 45..182 CDD:227410 71/136 (52%)
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 80/162 (49%)
UQ_con 8..159 CDD:278603 77/156 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.