DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and cdc34b

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001002688.1 Gene:cdc34b / 436961 ZFINID:ZDB-GENE-040718-439 Length:239 Species:Danio rerio


Alignment Length:252 Identity:166/252 - (65%)
Similarity:201/252 - (79%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LATSSSAAAPTTTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGG 88
            :|..|||..      :|:.:||.:|.|||||||||||::.|:::.:|:.|||||||||:|.|:||
Zfish     1 MAQQSSAQV------ASSQKALMLEMKSLQEEPVEGFKITLVDEADLYNWEVAIFGPPNTHYEGG 59

  Fly    89 YFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVR 153
            ||||.:|||.|||||||:.|||||:||||:|||||:||||||||||||||||||.||||||||||
Zfish    60 YFKARIKFPVDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVR 124

  Fly   154 TILLSVISLLNEPNTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMT 218
            ||||||||||||||||||||||||||||:||||:|||.||..|||||.||..|||:|:|:.||.|
Zfish   125 TILLSVISLLNEPNTFSPANVDASVMYRKWRDSKGKDREYAEIIRKQVLATKAEAERDGVKVPTT 189

  Fly   219 LEDYCLKPTRKPTTESGLDANFYDDDFDLETEDDLPSDDDFDEDDDDDEDEDEDEDS 275
            |.:||:: ||.|..:.|.|. .|||.:|   ::||  ||:.|||...|||:..:|:|
Zfish   190 LAEYCVR-TRAPAPDEGSDL-LYDDYYD---DEDL--DDENDEDCCYDEDDSGNEES 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 115/143 (80%)
COG5078 45..182 CDD:227410 111/136 (82%)
cdc34bNP_001002688.1 COG5078 9..172 CDD:227410 127/168 (76%)
UBCc 14..172 CDD:238117 126/157 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1929
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 336 1.000 Inparanoid score I2368
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - otm25921
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4188
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.