DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and CG14739

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:242 Identity:57/242 - (23%)
Similarity:97/242 - (40%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TTTPSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPH 98
            ||.|  .|.|.|..:...|.   ..|:|..:  ||::....|.:.||..:.|:||.:..::..|.
  Fly     9 TTLP--MAGRRLDRDVNRLL---ASGYRTTV--DDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQ 66

  Fly    99 DYPYSPPSIRFLTKVWHPNV-YENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVI-S 161
            |||.:.|.:||:||:.|||: :..|.:|:::|.             :.|:.:.::..|..:.: .
  Fly    67 DYPLTAPRVRFVTKILHPNIEFITGLVCMNVLK-------------QAWSSSYDLVNIFETFLPQ 118

  Fly   162 LLNEPNTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLK- 225
            ||..||.....|..|:.:.:.                      :.:..||.:::       |:| 
  Fly   119 LLRYPNPHDSLNHRAAAIMKH----------------------SEQLFREHVIL-------CMKT 154

  Fly   226 ---PTRKPT---TESGLDANFYDDDFDLETEDDLPSDDDFDEDDDDD 266
               |...||   .|.||:          :...||...|...:.||||
  Fly   155 YAMPANLPTRQLVEEGLE----------KRSSDLSLSDLLTDSDDDD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 36/145 (25%)
COG5078 45..182 CDD:227410 35/138 (25%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 42/193 (22%)
UQ_con 17..152 CDD:278603 37/181 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.