DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ubc6

DIOPT Version :10

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_524230.2 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:161 Identity:62/161 - (38%)
Similarity:91/161 - (56%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            |:.|.|.|..::|.|||:|..|.. ....|:|:..|...||||.||.::.|.||..::|..:||.
  Fly     2 STPARRRLMRDFKRLQEDPPTGVS-GAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPN 65

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167
            .||::||::||:|||||.:|.:|:.||.             .||:||.:|..||.|:.|||::||
  Fly    66 KPPTVRFVSKVFHPNVYADGGICLDILQ-------------NRWSPTYDVSAILTSIQSLLSDPN 117

  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIR 198
            ..||||..|:.:|:..|      .||...::
  Fly   118 PNSPANSTAAQLYKENR------REYEKRVK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc_UBE2R 43..212 CDD:467423 60/156 (38%)
Ubc6NP_524230.2 UBCc_UBE2A_2B 3..145 CDD:467410 61/160 (38%)

Return to query results.
Submit another query.