DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UbcE2M

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:195 Identity:47/195 - (24%)
Similarity:83/195 - (42%) Gaps:45/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EYKSLQEEPVEGFRVKLINDDN-----------------LFEWEVAIFGPPDTLYQGGYFKAHMK 95
            |.|..|::.....::::..|.|                 |..::: |..|.:..|:.|.|..:.:
  Fly    15 EQKGSQQKKASAAQLRIQKDINELNLPNTCATDFPDPNDLLNFKL-IISPDEGFYRDGRFVFNFR 78

  Fly    96 FPHDYPYSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVI 160
            ...:||:.||.::..|:|:|||:..:|::|::||.             |.|||..|:.:|:..:.
  Fly    79 VGSNYPHEPPKVKCATQVYHPNIDLDGNVCLNILR-------------EDWNPVLNINSIVYGLQ 130

  Fly   161 SLLNEPNTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLK 225
            .|..|||...|.|.:|:.:.      |....::.|.::|        |.|.|.|.....|...||
  Fly   131 FLFLEPNPEDPLNKEAADVL------QTNRRQFENNVKK--------AMRGGCVGETYFECCLLK 181

  Fly   226  225
              Fly   182  181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 37/154 (24%)
COG5078 45..182 CDD:227410 37/150 (25%)
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.