DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Uev1A

DIOPT Version :10

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:98 Identity:31/98 - (31%)
Similarity:48/98 - (48%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LINDDN--LFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYENGDLCI 126
            |.|||:  |..|...|.|||.|.::...:...::....||..||::||:|||   |:.     ||
  Fly    37 LENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKV---NIN-----CI 93

  Fly   127 SILHPPVDDPQSGELPCERWNPTQNVRTILLSV 159
            :..:..||......|  .||:...|::|:|..:
  Fly    94 NQNNGVVDHRSVQML--ARWSREYNIKTMLQEI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc_UBE2R 43..212 CDD:467423 31/98 (32%)
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 31/98 (32%)

Return to query results.
Submit another query.