DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2t

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001101814.2 Gene:Ube2t / 360847 RGDID:1310816 Length:204 Species:Rattus norvegicus


Alignment Length:161 Identity:50/161 - (31%)
Similarity:71/161 - (44%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAMEYKSLQEEPVEGFRVKLIND--DNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSI 107
            |..|...|..||..|.......|  |||   ...|.|..:|.|:.|.|...:..|..||:.||.|
  Rat     7 LKKELHMLAIEPPPGVTCWQEKDKMDNL---RAQILGGANTPYEKGIFTLEVIVPERYPFEPPQI 68

  Fly   108 RFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPA 172
            ||||.::|||:..:|.:|:.||..|         |...|.|:.|:.|:|.|:..|:.|||...|.
  Rat    69 RFLTPIYHPNIDSSGRICLDILKLP---------PKGAWRPSLNIATVLTSIQLLMAEPNPDDPL 124

  Fly   173 NVDASVMY-----------RRWRDSQGKDNE 192
            ..|.|..:           |:|.::..:..:
  Rat   125 MADISSEFKYNKIAFVKKARQWTETHARQKQ 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 50/153 (33%)
COG5078 45..182 CDD:227410 48/149 (32%)
Ube2tNP_001101814.2 UBCc 5..147 CDD:238117 49/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.