DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2o

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_221132.5 Gene:Ube2o / 303689 RGDID:1310297 Length:1291 Species:Rattus norvegicus


Alignment Length:311 Identity:69/311 - (22%)
Similarity:118/311 - (37%) Gaps:77/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYS 103
            |:..:.:|:...||.    :|..||.. :|.:..:...|.||..|.|:.|.:...::.|:.||..
  Rat   956 STVRKEMALLATSLP----DGIMVKTF-EDRMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAV 1015

  Fly   104 PPSIRFLTKV---WHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSV--ISLL 163
            ||...:|::.   .:||:|:||.:|:|:|...:..      ..|||....::..:|:|:  :.|:
  Rat  1016 PPHFCYLSQCSGRLNPNLYDNGKVCVSLLGTWIGK------GTERWTSKSSLLQVLISIQGLILV 1074

  Fly   164 NEPNTFSPANVDASVMYRRWRDSQGKDNEYPN--IIRKQALAANAEAKREGIVVPMTLEDYCLKP 226
            ||| .::.|..|:         .:|....|.|  ...:.||..        :|..||      :.
  Rat  1075 NEP-YYNEAGFDS---------DRGLQEGYENSRCYNEMALIR--------VVQSMT------QL 1115

  Fly   227 TRKP---------------------TTESGLDANFYDDDFDLETEDDLPSDDDFDED-------- 262
            .|:|                     ..||.|:.:..     ||....||:....|..        
  Rat  1116 VRRPPEVFEQEIRQHFSVGGWRLVNRIESWLETHVV-----LERAQALPNGVPKDSSSLEPQAAA 1175

  Fly   263 DDDDEDEDEDEDSATAPISKNNGGSSKCKNNGLVREAAAAGADDAESADDS 313
            :..|...:|.||....|...:.|..|:....| ...|:....:..|:|.|:
  Rat  1176 ELSDSGREEPEDVGMTPGEASQGSDSEGGAQG-PASASREHPEQTETAPDA 1225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 38/148 (26%)
COG5078 45..182 CDD:227410 38/141 (27%)
Ube2oXP_221132.5 UBCc 958..1108 CDD:238117 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.