DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2z

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001032732.2 Gene:Ube2z / 303478 RGDID:1308347 Length:356 Species:Rattus norvegicus


Alignment Length:339 Identity:78/339 - (23%)
Similarity:126/339 - (37%) Gaps:83/339 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AGSGSLATSSSAAAPTT-TPSSSAVRALAM---------------------------EYKSLQEE 55
            |.:|......|..||.. .|.|:|....|:                           :..|:.:|
  Rat    52 AAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKE 116

  Fly    56 PVEGFRVKLINDD-NLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTK-----VW 114
            |..|..|  :.|. ::.:....|.||.||.|:||:|....:.|.|||..||.::.:|.     .:
  Rat   117 PPPGMFV--VPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRF 179

  Fly   115 HPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVM 179
            :||.|.||.:|:|||         |......|:|.|::.::|:|:.||:.|    :|.:.:....
  Rat   180 NPNFYRNGKVCLSIL---------GTWTGPAWSPAQSISSVLISIQSLMTE----NPYHNEPGFE 231

  Fly   180 YRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPTTESGLDANFYDDD 244
            ..|   ..|....|...||.:.:       |..:...|..:..|.:|.|....:|.|:   |.|.
  Rat   232 QER---HPGDSKNYNECIRHETI-------RVAVCDMMEGKCPCPEPLRGVMEKSFLE---YYDF 283

  Fly   245 FDLETEDDLPSDDDFDEDDDDDEDEDEDEDSATAPISKNNGG---SSKCKNNGLVREAAAAGA-- 304
            :::..:|.|.......:|                |..:..|.   .|.....||:|:......  
  Rat   284 YEVACKDRLHLQGQTMQD----------------PFGEKRGHFDYQSLLMRLGLIRQKVLERLHN 332

  Fly   305 DDAESADDSGKGET 318
            ::||...||....|
  Rat   333 ENAEMDSDSSSSGT 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 43/176 (24%)
COG5078 45..182 CDD:227410 42/169 (25%)
Ube2zNP_001032732.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UBCc 105..223 CDD:238117 40/132 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..356 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.