DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Cdc34

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001013121.2 Gene:Cdc34 / 299602 RGDID:1305411 Length:235 Species:Rattus norvegicus


Alignment Length:235 Identity:155/235 - (65%)
Similarity:189/235 - (80%) Gaps:8/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYP 101
            |||.  :||.:|.|.|||||||||||.|:::.:|:.|||||||||:|.|:||||||.:|||.|||
  Rat     7 PSSQ--KALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYP 69

  Fly   102 YSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEP 166
            ||||:.|||||:||||:||.||:||||||||||||||||||.|||||||||||||||||||||||
  Rat    70 YSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEP 134

  Fly   167 NTFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLKPTRKPT 231
            |||||||||||||||:|::|:|||.||.:|||||.|....:|:|:|:.||.||.:||:| |:.|.
  Rat   135 NTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVK-TKAPA 198

  Fly   232 TESGLDANFYDDDF-DLETEDDLPSDDDFDEDDDDDEDED 270
            .:.|.|. ||||.: |.|.|:   :|..|.:::||...|:
  Rat   199 PDEGSDL-FYDDYYEDGEVEE---ADSCFGDEEDDSGTEE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 114/143 (80%)
COG5078 45..182 CDD:227410 111/136 (82%)
Cdc34NP_001013121.2 UBCc 11..162 CDD:238117 119/150 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1902
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 339 1.000 Inparanoid score I2292
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - otm45987
orthoMCL 1 0.900 - - OOG6_104162
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.