DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and ubc15

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_596465.1 Gene:ubc15 / 2539995 PomBaseID:SPBC1105.09 Length:167 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:78/163 - (47%)
Similarity:109/163 - (66%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYP 101
            |||::.:.|..:.|.:|:.|.:||.|.|::|.::|||||.|.||.||||:||:|.|.:.||.|||
pombe     2 PSSASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLSFPQDYP 66

  Fly   102 YSPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEP 166
            ..||.::|.|::|||||:.||::||||||||.||....|...|||.|..:..|||:||||:|:.|
pombe    67 LMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILISVISMLSSP 131

  Fly   167 NTFSPANVDASVMYRRWRDSQGKDNEYPNIIRK 199
            |..||||:||:..:|.      ...|:...:|:
pombe   132 NDESPANIDAAKEFRE------NPQEFKKRVRR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 73/143 (51%)
COG5078 45..182 CDD:227410 72/136 (53%)
ubc15NP_596465.1 COG5078 1..152 CDD:227410 76/155 (49%)
UQ_con 10..152 CDD:278603 73/147 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24067
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.