DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and ubc-22

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_509501.2 Gene:ubc-22 / 182322 WormBaseID:WBGene00006717 Length:182 Species:Caenorhabditis elegans


Alignment Length:127 Identity:32/127 - (25%)
Similarity:58/127 - (45%) Gaps:30/127 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VKLIN-DDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYENGDLC 125
            ::::| :|....:.:|  ||.||.|:.|.|:..:.||.:||.:.|.|:|.|.:|:..|       
 Worm    21 IEMVNEEDKKITFHIA--GPADTPYETGVFEVDLTFPDNYPNALPQIKFQTLIWNCAV------- 76

  Fly   126 ISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMY----RRW 183
                     :|.:|::..|.::     |..:...:|.:.:  .|....||..||:    |.|
 Worm    77 ---------EPSTGQVHIENYS-----RLNVSEALSYIED--LFRSIEVDEEVMFYKTARFW 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 32/127 (25%)
COG5078 45..182 CDD:227410 30/124 (24%)
ubc-22NP_509501.2 UBCc 5..128 CDD:294101 32/127 (25%)
UBA_like_SF 139..174 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.