DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and ubc-3

DIOPT Version :10

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_490882.3 Gene:ubc-3 / 171734 WormBaseID:WBGene00006702 Length:243 Species:Caenorhabditis elegans


Alignment Length:228 Identity:48/228 - (21%)
Similarity:78/228 - (34%) Gaps:64/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RRLLYSPEF--PSFPSLYALFVDSTSDTGRVNPSVRFMCFNPVSSKWYPLP----PPP------- 116
            |||:....|  ||..||::.|....           :...|.....|..||    |.|       
 Worm   211 RRLIGITSFNSPSHRSLFSQFCQEI-----------YFVRNSDKKSWQTLPQDQYPKPLIFHDGR 264

  Fly   117 ----PDPPLHRILYRHPSFISFNLPIQCVSAAGKLILIAGSNQQLSPAISHP-LIFDPISSSW-- 174
                |.|....:|:..       .|...|.||.:|:.  |.|  |..::::| |.|..|..:.  
 Worm   265 LAVKPTPLNTLVLFMW-------APFAAVLAAARLVF--GLN--LPYSLANPFLAFSGIHLTLTV 318

  Fly   175 -SSGPRIGSPRRWCATGACD-----GAIYIASGISSQFSSTVAKSVEKLDLTEQNRNNHRFNWEK 233
             :....|.:.|:......|:     ..:||:..:..:....|..|:.:|.             |.
 Worm   319 NNHNDLISADRKRGCLFVCNHRTLLDPLYISYALRKKNMKAVTYSLSRLS-------------EL 370

  Fly   234 LRDMRDLRFSREAIDAVGYRRKLLMVNVKGDAV 266
            |..::.:|.:|:.:.......|||.   :||.|
 Worm   371 LAPIKTVRLTRDRVKDGQAMEKLLS---QGDLV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc_UBE2R 43..212 CDD:467423 36/172 (21%)
ubc-3NP_490882.3 UBCc_UBE2R 13..179 CDD:467423
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.