DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and ubc-3

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_490882.3 Gene:ubc-3 / 171734 WormBaseID:WBGene00006702 Length:243 Species:Caenorhabditis elegans


Alignment Length:283 Identity:157/283 - (55%)
Similarity:192/283 - (67%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPY 102
            ||.|:|||.||.|:||.:|||||.:. :|:||||.|.|.|:|||.||||||||||.::||.:|||
 Worm     8 SSGALRALTMELKNLQSQPVEGFTID-VNEDNLFVWTVGIYGPPKTLYQGGYFKASIRFPSNYPY 71

  Fly   103 SPPSIRFLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPN 167
            ||||::|.||||||||||||||||||||.|:||||||||.||||||||:||||||||||||||||
 Worm    72 SPPSMKFTTKVWHPNVYENGDLCISILHSPIDDPQSGELACERWNPTQSVRTILLSVISLLNEPN 136

  Fly   168 TFSPANVDASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKREGIVVPMTLEDYCLK--PTRKP 230
            |.||||||||||||:|::.|  |.||..|:.||...:...|:::||.||.|:|:||:|  |.:: 
 Worm   137 TSSPANVDASVMYRKWKEDQ--DPEYAKIVTKQVEESKKVAQKDGIQVPETIEEYCVKWAPPQQ- 198

  Fly   231 TTESGLDANFYDDDFDLETEDDLPSDDDFDED-DDDDEDEDEDEDSATAPISKNNGGSSKCKNNG 294
                       ||.|     ||:..:|||..| |||:|:|||||                     
 Worm   199 -----------DDVF-----DDIDYNDDFGCDYDDDEEEEDEDE--------------------- 226

  Fly   295 LVREAAAAGADDAESADDSGKGE 317
                   .|:|..:..:|||:||
 Worm   227 -------CGSDYNDDDEDSGQGE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 111/143 (78%)
COG5078 45..182 CDD:227410 107/136 (79%)
ubc-3NP_490882.3 UBCc 13..168 CDD:238117 117/157 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165245
Domainoid 1 1.000 240 1.000 Domainoid score I1262
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3210
Inparanoid 1 1.050 302 1.000 Inparanoid score I1615
Isobase 1 0.950 - 0 Normalized mean entropy S539
OMA 1 1.010 - - QHG52149
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003335
OrthoInspector 1 1.000 - - oto17729
orthoMCL 1 0.900 - - OOG6_104162
Panther 1 1.100 - - LDO PTHR24067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4188
SonicParanoid 1 1.000 - - X1472
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.780

Return to query results.
Submit another query.