DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and UBE2E3

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001265483.1 Gene:UBE2E3 / 10477 HGNCID:12479 Length:207 Species:Homo sapiens


Alignment Length:216 Identity:56/216 - (25%)
Similarity:85/216 - (39%) Gaps:53/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASTSQHATSSSTMMAGSGSLATSSSAAAP-----------------TTTPSSSAVRALAMEYKSL 52
            :|..|.:...|...:...|.|.....|||                 .|..||.....|:...|.:
Human     2 SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRI 66

  Fly    53 QEEPVEGFRVKL---------INDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIR 108
            |:|..|   :.|         ...||::||...|.|||.::|:||.|...:.|..|||:.||.:.
Human    67 QKELAE---ITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVT 128

  Fly   109 FLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPAN 173
            |.|:::|.|:...|.:|:.||.             :.|:|...:..:|||:.|||.:.|...|..
Human   129 FRTRIYHCNINSQGVICLDILK-------------DNWSPALTISKVLLSICSLLTDCNPADPLV 180

  Fly   174 VDASVMY-----------RRW 183
            ...:..|           |:|
Human   181 GSIATQYLTNRAEHDRIARQW 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 45/162 (28%)
COG5078 45..182 CDD:227410 43/156 (28%)
UBE2E3NP_001265483.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 12/60 (20%)
UQ_con 65..202 CDD:395127 43/153 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.