Sequence 1: | NP_648783.4 | Gene: | CG7656 / 39691 | FlyBaseID: | FBgn0036516 | Length: | 319 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265483.1 | Gene: | UBE2E3 / 10477 | HGNCID: | 12479 | Length: | 207 | Species: | Homo sapiens |
Alignment Length: | 216 | Identity: | 56/216 - (25%) |
---|---|---|---|
Similarity: | 85/216 - (39%) | Gaps: | 53/216 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 ASTSQHATSSSTMMAGSGSLATSSSAAAP-----------------TTTPSSSAVRALAMEYKSL 52
Fly 53 QEEPVEGFRVKL---------INDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIR 108
Fly 109 FLTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPAN 173
Fly 174 VDASVMY-----------RRW 183 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7656 | NP_648783.4 | UBCc | 42..186 | CDD:238117 | 45/162 (28%) |
COG5078 | 45..182 | CDD:227410 | 43/156 (28%) | ||
UBE2E3 | NP_001265483.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..63 | 12/60 (20%) | |
UQ_con | 65..202 | CDD:395127 | 43/153 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |