DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and Ube2e1

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_038949665.1 Gene:Ube2e1 / 100366017 RGDID:2324438 Length:310 Species:Rattus norvegicus


Alignment Length:203 Identity:54/203 - (26%)
Similarity:86/203 - (42%) Gaps:47/203 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASTSQHATSSSTMMAGSGSLATSSSAAAPTTTPS----SSAVRALAMEYKSLQEEPVEGFRVKL- 64
            ||||..::|||...       |....:.|....|    |...:.|:...|.:|:|..:   :.| 
  Rat   125 ASTSSSSSSSSNQQ-------TEKEGSTPKKKESKVSMSKNSKLLSTSAKRIQKELAD---ITLD 179

  Fly    65 --------INDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYEN 121
                    ...||::||...|.|||.::|:||.|...:.|..:||:.||.:.|.|:::|.|:...
  Rat   180 PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQ 244

  Fly   122 GDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMY------ 180
            |.:|:.||.             :.|:|...:..:|||:.|||.:.|...|.....:..|      
  Rat   245 GVICLDILK-------------DNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAE 296

  Fly   181 -----RRW 183
                 |:|
  Rat   297 HDRMARQW 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 43/162 (27%)
COG5078 45..182 CDD:227410 41/156 (26%)
Ube2e1XP_038949665.1 PHA03378 <19..>108 CDD:223065
UQ_con 168..305 CDD:395127 41/153 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.