DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7656 and ube2g1b

DIOPT Version :9

Sequence 1:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_998695.1 Gene:ube2g1b / 100000479 ZFINID:ZDB-GENE-040426-2939 Length:169 Species:Danio rerio


Alignment Length:167 Identity:80/167 - (47%)
Similarity:108/167 - (64%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRF 109
            |..:...|.:.|||||...||:||::::|||.:.||.||:::||:||||:.||||||..||.::|
Zfish     9 LRKQLAELNKNPVEGFSAGLIDDDDIYQWEVVVIGPQDTMFEGGFFKAHLIFPHDYPLRPPKMKF 73

  Fly   110 LTKVWHPNVYENGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLSVISLLNEPNTFSPANV 174
            :|::|||||.:|||:||||||.|.:|....|.|.|||.|...|.||::||||:|.:||..|||||
Zfish    74 ITEIWHPNVAKNGDVCISILHEPGEDKFGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANV 138

  Fly   175 DASVMYRRWRDSQGKDNEYPNIIRKQALAANAEAKRE 211
            ||:   :.|||.                 .|.|.||:
Zfish   139 DAA---KEWRDD-----------------PNGEFKRK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7656NP_648783.4 UBCc 42..186 CDD:238117 75/140 (54%)
COG5078 45..182 CDD:227410 73/136 (54%)
ube2g1bNP_998695.1 COG5078 1..163 CDD:227410 80/167 (48%)
UQ_con 9..160 CDD:278603 80/167 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0425
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1317014at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.