DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and DBF20

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_015436.1 Gene:DBF20 / 856227 SGDID:S000006315 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:416 Identity:131/416 - (31%)
Similarity:201/416 - (48%) Gaps:73/416 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 PQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDILSFADNPF 894
            |:..||.|:..:..|.||.|||.|.|.:.:..|:|.:||..|...|:...|..|||||:...:.:
Yeast   164 PKHKDFQILTQVGQGGYGQVYLAKKKDSDEICALKILNKKLLFKLNETNHVLTERDILTTTRSDW 228

  Fly   895 VVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHSYGIVHRDL 959
            :|.:..:|:..:.|.|.||:|.|||..|||.|...|.:..||||.:|...||..||..|..||||
Yeast   229 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRILKSGHARFYISEMFCAVNALHELGYTHRDL 293

  Fly   960 KPDNLLITALGHIKLTDFGLS------------KMGLMSLATNLYEGYIDSETRQFSD-KQVY-- 1009
            ||:|.||.|.||||||||||:            |:.|..:....:..:.:   |...| :::|  
Yeast   294 KPENFLIDATGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTE---RSIEDRRKIYHN 355

  Fly  1010 -------------GTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHT- 1060
                         |:|:|:|.||:..:.|...||:||:|.:|:|.|:|..||.|.:|.|.:.:. 
Yeast   356 MRKTEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLR 420

  Fly  1061 -VNDDIEWPDSED---------WPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDW 1115
             ....:..|.:||         |       |:|::|: .:|.:|:.:..   ::::..||..:::
Yeast   421 YWKKTLRRPRTEDRRAAFSDRTW-------DLITRLI-ADPINRVRSFE---QVRKMSYFAEINF 474

  Fly  1116 NSLLRQKAEFVPQLSHDDDTSYFDTRMDRYNHDLGGEDTD----------DTDDTPVFGSFNSYT 1170
            .:|......|:|||..:.|..|||   |..|.:...:..|          ..||:.|......:|
Yeast   475 ETLRTSSPPFIPQLDDETDAGYFD---DFTNEEDMAKYADVFKRQNKLSAMVDDSAVDSKLVGFT 536

  Fly  1171 PQYR--KQH-----YSWSRHATPTST 1189
            .::|  ||.     |:.|.|:.|.||
Yeast   537 FRHRDGKQGSSGILYNGSEHSDPFST 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 105/319 (33%)
S_TKc 835..1110 CDD:214567 102/313 (33%)
PDZ_signaling 1506..1587 CDD:238492
DBF20NP_015436.1 STKc_Sid2p_like 157..539 CDD:270751 122/391 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344972
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.