DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Stk32b

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_071861.1 Gene:Stk32b / 64293 MGIID:1927552 Length:414 Species:Mus musculus


Alignment Length:329 Identity:99/329 - (30%)
Similarity:164/329 - (49%) Gaps:65/329 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   828 PSPQEND------FDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDI 886
            |...||:      |.|::.|..|::|.|.:|:.:.|::.:|||.:||...:.|::|..||.|..|
Mouse    10 PVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCVERDEVRNVFRELQI 74

  Fly   887 LSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHS 951
            :...::||:|:::.||:.::.:.:|::.:.|||....|:..........:.|..|..||:|||..
Mouse    75 MQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGTVKLYICELALALEYLQR 139

  Fly   952 YGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDK--QVYGTPEY 1014
            |.|:|||:||||:|:...||:.:|||        ::||.|          :.|:|  .:.||..|
Mouse   140 YHIIHRDIKPDNILLDEHGHVHITDF--------NIATVL----------KGSEKASSMAGTKPY 186

  Fly  1015 IAPEVIL-----RQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVNDDI--------- 1065
            :||||..     ..||..||||||:|:..||.|.|..|:      |:.:.|..|:|         
Mouse   187 MAPEVFQVYVDGGPGYSYPVDWWSLGVTAYELLRGWRPY------EIHSATPIDEILNMFKVERV 245

  Fly  1066 ----EWPDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQKA--- 1123
                .|.:.        ...::.:||.::|..||   |...:::...|...|:|:::. :||   
Mouse   246 HYSSTWCEG--------MVSLLKKLLTKDPESRL---SSLRDIQSMTYLADMNWDAVF-EKALMP 298

  Fly  1124 EFVP 1127
            .|||
Mouse   299 GFVP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 90/306 (29%)
S_TKc 835..1110 CDD:214567 88/294 (30%)
PDZ_signaling 1506..1587 CDD:238492
Stk32bNP_071861.1 STKc_Yank1 22..283 CDD:270730 88/295 (30%)
S_TKc 23..272 CDD:214567 87/283 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.