DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Stk32c

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_067277.2 Gene:Stk32c / 57740 MGIID:2385336 Length:488 Species:Mus musculus


Alignment Length:417 Identity:123/417 - (29%)
Similarity:195/417 - (46%) Gaps:69/417 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 MDSG------SGTATPQQPP--QTPVATCDTAPSF-ALAISQMNEEKGGSSSA-----VGGGSSS 804
            |.||      |..|.|..||  :...|..|.:|:. ..|.||......|.:.|     .......
Mouse     1 MRSGAERRGSSAAAPPSSPPPGRARPAGSDVSPALPPPAASQPRARDAGDARAQPRPLFQWSKWK 65

  Fly   805 KVAGAEGITGGSAATATGSGAQQPSPQEND------FDIVKLISNGAYGAVYLVKHKTTRQRFAM 863
            |......|:.||        |::|...:.:      |.|::.|..|::|.|.:|:.:.|.:.:||
Mouse    66 KRMSMSSISSGS--------ARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYAM 122

  Fly   864 KKINKNNLILRNQVEQVFAERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIG 928
            |.:||...|.|::|..||.|.:||...::.|:|:::.||:.::.:.:|::.:.|||....|:...
Mouse   123 KYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNV 187

  Fly   929 PLPADMARFYFAETVLAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYE 993
            ....|..|.|..|..||::||.|..|:|||:||||:|:...||..||||        ::||.:.:
Mouse   188 QFSEDTVRLYICEMALALDYLRSQHIIHRDVKPDNILLDEQGHAHLTDF--------NIATIIKD 244

  Fly   994 GYIDSETRQFSDKQVYGTPEYIAPEVILR-----QGYGKPVDWWSMGIILYEFLIGCVPF----- 1048
            |  :..|      .:.||..|:|||:...     .||...|||||:|::.||.|.|..|:     
Mouse   245 G--ERAT------ALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS 301

  Fly  1049 -FGETTEELFAHTVNDDIEWPDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLG 1112
             ..|:..:||: ||:  :::..:  |..:..|  ::.:||..||..|.   |...:|:.......
Mouse   302 NAVESLVQLFS-TVS--VQYVPT--WSKEMVA--LLRKLLTVNPEHRF---SSLQDMQTAPSLAH 356

  Fly  1113 MDWNSLLRQKAE--FVPQLS--HDDDT 1135
            :.|:.|..:|.|  |||...  |.|.|
Mouse   357 VLWDDLSEKKVEPGFVPNKGRLHCDPT 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 91/297 (31%)
S_TKc 835..1110 CDD:214567 91/285 (32%)
PDZ_signaling 1506..1587 CDD:238492
Stk32cNP_067277.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 16/54 (30%)
STKc_Yank1 93..352 CDD:270730 91/284 (32%)
S_TKc 94..349 CDD:214567 90/280 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.