DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Akt1

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_732113.3 Gene:Akt1 / 41957 FlyBaseID:FBgn0010379 Length:611 Species:Drosophila melanogaster


Alignment Length:448 Identity:140/448 - (31%)
Similarity:225/448 - (50%) Gaps:71/448 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 TSAAKQLSSLALDAIAMDSGSGTATPQQPPQTPVATCDTAPSFALAISQMNEEKGGSSSAVGGGS 802
            |.|.:.:||..:|.     |....||.:  ||.:...|.|   .:|..:::|:            
  Fly   203 TEAIRNVSSRLIDV-----GEVAMTPSE--QTDMTDVDMA---TIAEDELSEQ------------ 245

  Fly   803 SSKVAGAEGITGGSAATATGSGAQQPSPQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKIN 867
             ..|.|         .|...||.::.:.:  :|:.:|::..|.:|.|.|.:.|.|.:.:|:|.:.
  Fly   246 -FSVQG---------TTCNSSGVKKVTLE--NFEFLKVLGKGTFGKVILCREKATAKLYAIKILK 298

  Fly   868 KNNLILRNQVEQVFAERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPA 932
            |..:|.:::|.....|..:|...::||::|:..||:|...||.||:||.||:....|.:......
  Fly   299 KEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTE 363

  Fly   933 DMARFYFAETVLAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYID 997
            |..|||.||.:.|:.||||.||::||||.:|||:...||||:.||||.|               :
  Fly   364 DRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCK---------------E 413

  Fly   998 SETRQFSDKQVYGTPEYIAPEVILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVN 1062
            ..|...:.|...|||||:||||:....||:.||||..|:::||.:.|.:||:....:.||...:.
  Fly   414 DITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILV 478

  Fly  1063 DDIEWPDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKE---HEYFLGMDWNSLLRQK-- 1122
            :::::|.:    :..|||::::.||.::|:.|||  .|..::||   |.:|..::|..|:.:|  
  Fly   479 EEVKFPRN----ITDEAKNLLAGLLAKDPKKRLG--GGKDDVKEIQAHPFFASINWTDLVLKKIP 537

  Fly  1123 AEFVPQLSHDDDTSYFDTRMDRYNHDLGGEDTDDT--DDTPVFGSF--NSYTPQYRKQ 1176
            ..|.||::.|.||.|||       .:..||..:.|  |.|...||.  ....||:..|
  Fly   538 PPFKPQVTSDTDTRYFD-------KEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQ 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 99/283 (35%)
S_TKc 835..1110 CDD:214567 98/277 (35%)
PDZ_signaling 1506..1587 CDD:238492
Akt1NP_732113.3 PH_PKB 105..214 CDD:269947 4/10 (40%)
PH 107..211 CDD:278594 2/7 (29%)
S_TKc 266..523 CDD:214567 98/277 (35%)
STKc_PKB 270..590 CDD:270723 120/347 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.