DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Stk32c

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_001102392.1 Gene:Stk32c / 365381 RGDID:1305864 Length:488 Species:Rattus norvegicus


Alignment Length:416 Identity:123/416 - (29%)
Similarity:197/416 - (47%) Gaps:67/416 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 MDSG------SGTATPQQPP--QTPVATCDTAPSF-ALAISQMNEEKGGSSSA----VGGGSSSK 805
            |.||      |..|.|..||  :...|..|.:|:. ..|.||......|.:.|    :...|..|
  Rat     1 MRSGAERRGSSAAAPPGSPPPGRARPAGSDVSPALPPPAASQPRARDAGDARAQPRPLFQWSKWK 65

  Fly   806 VAGAEGITGGSAATATGSGAQQPSPQEND------FDIVKLISNGAYGAVYLVKHKTTRQRFAMK 864
                   ...|.::.:.|.|::|...:.:      |.|::.|..|::|.|.:|:.:.|.:.:|||
  Rat    66 -------KRMSMSSISASSARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYAMK 123

  Fly   865 KINKNNLILRNQVEQVFAERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGP 929
            .:||...|.|::|..||.|.:||...::.|:|:::.||:.::.:.:|::.:.|||....|:....
  Rat   124 YMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQ 188

  Fly   930 LPADMARFYFAETVLAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEG 994
            ...|..|.|..|..||::||.|..|:|||:||||:|:...||..||||        ::||.:.:|
  Rat   189 FSEDTVRLYICEMALALDYLRSQHIIHRDVKPDNILLDEQGHAHLTDF--------NIATIIKDG 245

  Fly   995 YIDSETRQFSDKQVYGTPEYIAPEVILR-----QGYGKPVDWWSMGIILYEFLIGCVPF------ 1048
              :..|      .:.||..|:|||:...     .||...|||||:|::.||.|.|..|:      
  Rat   246 --ERAT------ALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSSN 302

  Fly  1049 FGETTEELFAHTVNDDIEWPDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGM 1113
            ..|:..:||: ||:  :::..:  |.....|  ::.:||..||..|.   |...:|:.......:
  Rat   303 AVESLVQLFS-TVS--VQYVPT--WSKGMVA--LLRKLLTVNPEHRF---SSLQDMQTAPSLAHV 357

  Fly  1114 DWNSLLRQKAE--FVPQLS--HDDDT 1135
            .|:.|..:|.|  |||...  |.|.|
  Rat   358 LWDELSEKKVEPGFVPNKGRLHCDPT 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 91/297 (31%)
S_TKc 835..1110 CDD:214567 91/285 (32%)
PDZ_signaling 1506..1587 CDD:238492
Stk32cNP_001102392.1 STKc_Yank1 93..352 CDD:270730 91/284 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.