DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Stk32a

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_001178823.1 Gene:Stk32a / 364858 RGDID:1308338 Length:397 Species:Rattus norvegicus


Alignment Length:319 Identity:95/319 - (29%)
Similarity:169/319 - (52%) Gaps:37/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 SGAQQPSPQEND------FDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVF 881
            :.::.|...||:      |:|::.|..|::|.|.:|:...|::.:|||.:||...:.||:|..||
  Rat     5 TSSKAPVLDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVF 69

  Fly   882 AERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAV 946
            .|..|:...::||:|:::.||:.::.:.:|::.:.|||....|:.......|..:.:..|..:|:
  Rat    70 KELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQEDTVKLFICELAMAL 134

  Fly   947 EYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVYGT 1011
            :||.|..|:|||:||||:|:...||:.:|||.::.|             :..|||..:   |.||
  Rat   135 DYLQSQRIIHRDMKPDNILLDEHGHVHITDFNIAAM-------------LPKETRITT---VAGT 183

  Fly  1012 PEYIAPEVI---LRQGYGKPVDWWSMGIILYEFLIGCVPFF---GETTEELFAHTVNDDIEWPDS 1070
            ..|:|||:.   ...||...|||||:|:..||.|.|..|:.   ..:::|:........:.:|.:
  Rat   184 KPYMAPEMFSSRKESGYSFAVDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVNMFETAIVTYPSA 248

  Fly  1071 EDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQK--AEFVP 1127
              |  .||...::.:||:.||..|.   |...:::...|...|:|:::|:::  ..|||
  Rat   249 --W--SAEMVSLLKKLLEPNPDQRF---SHLTDIQNFPYMSDMNWDAVLQKRLIPGFVP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 87/292 (30%)
S_TKc 835..1110 CDD:214567 85/280 (30%)
PDZ_signaling 1506..1587 CDD:238492
Stk32aNP_001178823.1 STKc_Yank1 22..281 CDD:270730 85/281 (30%)
S_TKc 23..270 CDD:214567 84/269 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.